                                   merger



Wiki

   The master copies of EMBOSS documentation are available at
   http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

   Please help by correcting and extending the Wiki pages.

Function

   Merge two overlapping sequences

Description

   merger reads two overlapping input sequences of the same type
   (typically nucleotide) and uses a global alignment algorithm (Needleman
   & Wunsch) to optimally align the sequences. A merged sequence is
   generated from the alignment and writen to the output file. The
   sequence alignment is also written.

Algorithm

   It uses a global alignment algorithm (Needleman & Wunsch) to optimally
   align the sequences and then creates a merged sequence from the
   alignment. When there is a mismatch in the alignment between the two
   sequences, the base included in the merged sequence is the base from
   the sequence which has the best local sequence quality score.

   The following heuristic is used to find the sequence quality score. If
   one of the bases is a 'N', then the other sequence's base is used.
   Otherwise, a window size around the disputed base is used to find the
   local quality score. This window size is increased from 5, to 10 to 20
   bases or until there is a clear decision on the best choice. If there
   is no best choice after using a window of 20, then the base in the
   first sequence is used.

   To calculate the quality of a window of a sequence around a base:
    * quality = sequence value/length under window either side of the base
    * sequence value = sum of points in that window
    * unambiguous bases (ACGTU) score 2 points
    * ambiguous bases (MRWSYKVHDB) score 1 point
    * Ns score 0 points
    * off end of the sequence scores 0 points

   This heavily discriminates against the iffy bits at the end of sequence
   reads.

Usage

   Here is a sample session with merger


% merger
Merge two overlapping sequences
Input sequence: tembl:v00295
Second sequence: tembl:x51872
Output alignment [v00295.merger]:
output sequence [v00295.fasta]:


   Go to the input files for this example
   Go to the output files for this example

   Typically, one of the sequences will need to be reverse-complemented to
   put it into the correct orientation to make it join. For example:

% merger file1.seq file2.seq -sreverse2 -outseq merged.seq

Command line arguments

Merge two overlapping sequences
Version: EMBOSS:6.5.6.0

   Standard (Mandatory) qualifiers:
  [-asequence]         sequence   Sequence filename and optional format, or
                                  reference (input USA)
  [-bsequence]         sequence   Sequence filename and optional format, or
                                  reference (input USA)
  [-outfile]           align      [*.merger] Output alignment file name
                                  (default -aformat simple)
  [-outseq]            seqout     [.] Sequence filename and
                                  optional format (output USA)

   Additional (Optional) qualifiers:
   -datafile           matrixf    [EBLOSUM62 for protein, EDNAFULL for DNA]
                                  This is the scoring matrix file used when
                                  comparing sequences. By default it is the
                                  file 'EBLOSUM62' (for proteins) or the file
                                  'EDNAFULL' (for nucleic sequences). These
                                  files are found in the 'data' directory of
                                  the EMBOSS installation.
   -gapopen            float      [@($(acdprotein)? 50.0 : 50.0 )] Gap opening
                                  penalty (Number from 0.000 to 100.000)
   -gapextend          float      [@($(acdprotein)? 5.0 : 5.0)] Gap extension
                                  penalty (Number from 0.000 to 10.000)

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-asequence" associated qualifiers
   -sbegin1            integer    Start of the sequence to be used
   -send1              integer    End of the sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -scircular1         boolean    Sequence is circular
   -sformat1           string     Input sequence format
   -iquery1            string     Input query fields or ID list
   -ioffset1           integer    Input start position offset
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-bsequence" associated qualifiers
   -sbegin2            integer    Start of the sequence to be used
   -send2              integer    End of the sequence to be used
   -sreverse2          boolean    Reverse (if DNA)
   -sask2              boolean    Ask for begin/end/reverse
   -snucleotide2       boolean    Sequence is nucleotide
   -sprotein2          boolean    Sequence is protein
   -slower2            boolean    Make lower case
   -supper2            boolean    Make upper case
   -scircular2         boolean    Sequence is circular
   -sformat2           string     Input sequence format
   -iquery2            string     Input query fields or ID list
   -ioffset2           integer    Input start position offset
   -sdbname2           string     Database name
   -sid2               string     Entryname
   -ufo2               string     UFO features
   -fformat2           string     Features format
   -fopenfile2         string     Features file name

   "-outfile" associated qualifiers
   -aformat3           string     Alignment format
   -aextension3        string     File name extension
   -adirectory3        string     Output directory
   -aname3             string     Base file name
   -awidth3            integer    Alignment width
   -aaccshow3          boolean    Show accession number in the header
   -adesshow3          boolean    Show description in the header
   -ausashow3          boolean    Show the full USA in the alignment
   -aglobal3           boolean    Show the full sequence in alignment

   "-outseq" associated qualifiers
   -osformat4          string     Output seq format
   -osextension4       string     File name extension
   -osname4            string     Base file name
   -osdirectory4       string     Output directory
   -osdbname4          string     Database name to add
   -ossingle4          boolean    Separate file for each entry
   -oufo4              string     UFO features
   -offormat4          string     Features format
   -ofname4            string     Features file name
   -ofdirectory4       string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit


Input file format

   merger reads two nucleotide or protein sequences.

   The input is a standard EMBOSS sequence query (also known as a 'USA').

   Major sequence database sources defined as standard in EMBOSS
   installations include srs:embl, srs:uniprot and ensembl

   Data can also be read from sequence output in any supported format
   written by an EMBOSS or third-party application.

   The input format can be specified by using the command-line qualifier
   -sformat xxx, where 'xxx' is replaced by the name of the required
   format. The available format names are: gff (gff3), gff2, embl (em),
   genbank (gb, refseq), ddbj, refseqp, pir (nbrf), swissprot (swiss, sw),
   dasgff and debug.

   See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further
   information on sequence formats.

  Input files for usage example

   'tembl:v00295' is a sequence entry in the example nucleic acid database
   'tembl'

  Database entry: tembl:v00295

ID   V00295; SV 1; linear; genomic DNA; STD; PRO; 1500 BP.
XX
AC   V00295;
XX
DT   09-JUN-1982 (Rel. 01, Created)
DT   07-JUL-1995 (Rel. 44, Last updated, Version 4)
XX
DE   E. coli lacY gene (codes for lactose permease).
XX
KW   membrane protein.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-1500
RX   DOI; 10.1038/283541a0.
RX   PUBMED; 6444453.
RA   Buechel D.E., Gronenborn B., Mueller-Hill B.;
RT   "Sequence of the lactose permease gene";
RL   Nature 283(5747):541-545(1980).
XX
CC   lacZ is a beta-galactosidase and lacA is transacetylase.
CC   KST ECO.LACY
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1500
FT                   /organism="Escherichia coli"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   CDS             <1..54
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="reading frame (lacZ)"
FT                   /db_xref="GOA:P00722"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"


  [Part of this file has been deleted for brevity]

FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   CDS             1423..>1500
FT                   /transl_table=11
FT                   /note="reading frame (lacA)"
FT                   /db_xref="GOA:P07464"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="PDB:1KQA"
FT                   /db_xref="PDB:1KRR"
FT                   /db_xref="PDB:1KRU"
FT                   /db_xref="PDB:1KRV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07464"
FT                   /protein_id="CAA23572.1"
FT                   /translation="MNMPMTERIRAGKLFTDMCEGLPEKR"
XX
SQ   Sequence 1500 BP; 315 A; 342 C; 357 G; 486 T; 0 other;
     ttccagctga gcgccggtcg ctaccattac cagttggtct ggtgtcaaaa ataataataa        60
     ccgggcaggc catgtctgcc cgtatttcgc gtaaggaaat ccattatgta ctatttaaaa       120
     aacacaaact tttggatgtt cggtttattc tttttctttt acttttttat catgggagcc       180
     tacttcccgt ttttcccgat ttggctacat gacatcaacc atatcagcaa aagtgatacg       240
     ggtattattt ttgccgctat ttctctgttc tcgctattat tccaaccgct gtttggtctg       300
     ctttctgaca aactcgggct gcgcaaatac ctgctgtgga ttattaccgg catgttagtg       360
     atgtttgcgc cgttctttat ttttatcttc gggccactgt tacaatacaa cattttagta       420
     ggatcgattg ttggtggtat ttatctaggc ttttgtttta acgccggtgc gccagcagta       480
     gaggcattta ttgagaaagt cagccgtcgc agtaatttcg aatttggtcg cgcgcggatg       540
     tttggctgtg ttggctgggc gctgtgtgcc tcgattgtcg gcatcatgtt caccatcaat       600
     aatcagtttg ttttctggct gggctctggc tgtgcactca tcctcgccgt tttactcttt       660
     ttcgccaaaa cggatgcgcc ctcttctgcc acggttgcca atgcggtagg tgccaaccat       720
     tcggcattta gccttaagct ggcactggaa ctgttcagac agccaaaact gtggtttttg       780
     tcactgtatg ttattggcgt ttcctgcacc tacgatgttt ttgaccaaca gtttgctaat       840
     ttctttactt cgttctttgc taccggtgaa cagggtacgc gggtatttgg ctacgtaacg       900
     acaatgggcg aattacttaa cgcctcgatt atgttctttg cgccactgat cattaatcgc       960
     atcggtggga aaaacgccct gctgctggct ggcactatta tgtctgtacg tattattggc      1020
     tcatcgttcg ccacctcagc gctggaagtg gttattctga aaacgctgca tatgtttgaa      1080
     gtaccgttcc tgctggtggg ctgctttaaa tatattacca gccagtttga agtgcgtttt      1140
     tcagcgacga tttatctggt ctgtttctgc ttctttaagc aactggcgat gatttttatg      1200
     tctgtactgg cgggcaatat gtatgaaagc atcggtttcc agggcgctta tctggtgctg      1260
     ggtctggtgg cgctgggctt caccttaatt tccgtgttca cgcttagcgg ccccggcccg      1320
     ctttccctgc tgcgtcgtca ggtgaatgaa gtcgcttaag caatcaatgt cggatgcggc      1380
     gcgacgctta tccgaccaac atatcataac ggagtgatcg cattgaacat gccaatgacc      1440
     gaaagaataa gagcaggcaa gctatttacc gatatgtgcg aaggcttacc ggaaaaaaga      1500
//

  Database entry: tembl:x51872

ID   X51872; SV 1; linear; genomic DNA; STD; PRO; 1832 BP.
XX
AC   X51872;
XX
DT   17-APR-1990 (Rel. 23, Created)
DT   05-JUL-1999 (Rel. 60, Last updated, Version 5)
XX
DE   Escherichia coli lacA gene for thiogalactoside transacetylase
XX
KW   lac operon; lacA gene; lacY gene; thiogalactoside transacetylase.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RC   (1-1832)
RP   1-1832
RX   DOI; 10.1073/pnas.82.19.6414.
RX   PUBMED; 3901000.
RA   Hediger M.A., Johnson D.F., Nierlich D.P., Zabin I.;
RT   "DNA sequence of the lactose operon: the lacA gene and the transcriptional
RT   termination region";
RL   Proc. Natl. Acad. Sci. U.S.A. 82(19):6414-6418(1985).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1832
FT                   /organism="Escherichia coli"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   CDS             <1..18
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lacY gene product"
FT                   /protein_id="CAA36161.1"
FT                   /translation="VNEVA"
FT   CDS             82..693
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /product="thiogalactoside transacetylase"
FT                   /db_xref="GOA:P07464"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="PDB:1KQA"
FT                   /db_xref="PDB:1KRR"
FT                   /db_xref="PDB:1KRU"
FT                   /db_xref="PDB:1KRV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07464"
FT                   /protein_id="CAA36162.1"
FT                   /translation="MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV"
XX
SQ   Sequence 1832 BP; 519 A; 510 C; 450 G; 353 T; 0 other;
     gtgaatgaag tcgcttaagc aatcaatgtc ggatgcggcg cgacgcttat ccgaccaaca        60
     tatcataacg gagtgatcgc attgaacatg ccaatgaccg aaagaataag agcaggcaag       120
     ctatttaccg atatgtgcga aggcttaccg gaaaaaagac ttcgtgggaa aacgttaatg       180
     tatgagttta atcactcgca tccatcagaa gttgaaaaaa gagaaagcct gattaaagaa       240
     atgtttgcca cggtagggga aaacgcctgg gtagaaccgc ctgtctattt ctcttacggt       300
     tccaacatcc atataggccg caatttttat gcaaatttca atttaaccat tgtcgatgac       360
     tacacggtaa caatcggtga taacgtactg attgcaccca acgttactct ttccgttacg       420
     ggacaccctg tacaccatga attgagaaaa aacggcgaga tgtactcttt tccgataacg       480
     attggcaata acgtctggat cggaagtcat gtggttatta atccaggcgt caccatcggg       540
     gataattctg ttattggcgc gggtagtatc gtcacaaaag acattccacc aaacgtcgtg       600
     gcggctggcg ttccttgtcg ggttattcgc gaaataaacg accgggataa gcactattat       660
     ttcaaagatt ataaagttga atcgtcagtt taaattataa aaattgcctg atacgctgcg       720
     cttatcaggc ctacaagttc agcgatctac attagccgca tccggcatga acaaagcgca       780
     ggaacaagcg tcgcatcatg cctctttgac ccacagctgc ggaaaacgta ctggtgcaaa       840
     acgcagggtt atgatcatca gcccaacgac gcacagcgca tgaaatgccc agtccatcag       900
     gtaattgccg ctgatactac gcagcacgcc agaaaaccac ggggcaagcc cggcgatgat       960
     aaaaccgatt ccctgcataa acgccaccag cttgccagca atagccggtt gcacagagtg      1020
     atcgagcgcc agcagcaaac agagcggaaa cgcgccgccc agacctaacc cacacaccat      1080
     cgcccacaat accggcaatt gcatcggcag ccagataaag ccgcagaacc ccaccagttg      1140
     taacaccagc gccagcatta acagtttgcg ccgatcctga tggcgagcca tagcaggcat      1200
     cagcaaagct cctgcggctt gcccaagcgt catcaatgcc agtaaggaac cgctgtactg      1260
     cgcgctggca ccaatctcaa tatagaaagc gggtaaccag gcaatcaggc tggcgtaacc      1320
     gccgttaatc agaccgaagt aaacacccag cgtccacgcg cggggagtga ataccacgcg      1380
     aaccggagtg gttgttgtct tgtgggaaga ggcgacctcg cgggcgcttt gccaccacca      1440
     ggcaaagagc gcaacaacgg caggcagcgc caccaggcga gtgtttgata ccaggtttcg      1500
     ctatgttgaa ctaaccaggg cgttatggcg gcaccaagcc caccgccgcc catcagagcc      1560
     gcggaccaca gccccatcac cagtggcgtg cgctgctgaa accgccgttt aatcaccgaa      1620
     gcatcaccgc ctgaatgatg ccgatcccca ccccaccaag cagtgcgctg ctaagcagca      1680
     gcgcactttg cgggtaaagc tcacgcatca atgcaccgac ggcaatcagc aacagactga      1740
     tggcgacact gcgacgttcg ctgacatgct gatgaagcca gcttccggcc agcgccagcc      1800
     cgcccatggt aaccaccggc agagcggtcg ac                                    1832
//

Output file format

   The output is a standard EMBOSS alignment file.

   The results can be output in one of several styles by using the
   command-line qualifier -aformat xxx, where 'xxx' is replaced by the
   name of the required format. Some of the alignment formats can cope
   with an unlimited number of sequences, while others are only for pairs
   of sequences.

   The available multiple alignment format names are: multiple, simple,
   fasta, msf, clustal, mega, meganon, nexus,, nexusnon, phylip,
   phylipnon, selex, treecon, tcoffee, debug, srs.

   The available pairwise alignment format names are: pair, markx0,
   markx1, markx2, markx3, markx10, match, sam, bam, score, srspair

   See: http://emboss.sf.net/docs/themes/AlignFormats.html for further
   information on alignment formats.

   The output is a standard EMBOSS sequence file.

   The results can be output in one of several styles by using the
   command-line qualifier -osformat xxx, where 'xxx' is replaced by the
   name of the required format. The available format names are: embl,
   genbank, gff, pir, swiss, dasgff, debug, listfile, dbmotif, diffseq,
   excel, feattable, motif, nametable, regions, seqtable, simple, srs,
   table, tagseq.

   See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further
   information on sequence formats.

  Output files for usage example

  File: v00295.merger

########################################
# Program: merger
# Rundate: Sun 15 Jul 2012 12:00:00
# Commandline: merger
#    -asequence tembl:v00295
#    -bsequence tembl:x51872
# Align_format: simple
# Report_file: v00295.merger
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: V00295
# 2: X51872
# Matrix: EDNAFULL
# Gap_penalty: 50.0
# Extend_penalty: 5.0
#
# Length: 3173
# Identity:     159/3173 ( 5.0%)
# Similarity:   159/3173 ( 5.0%)
# Gaps:        3014/3173 (95.0%)
# Score: 795.0
#
#
#=======================================

V00295             1 ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaa     50

X51872             1 --------------------------------------------------      0

V00295            51 ataataataaccgggcaggccatgtctgcccgtatttcgcgtaaggaaat    100

X51872             1 --------------------------------------------------      0

V00295           101 ccattatgtactatttaaaaaacacaaacttttggatgttcggtttattc    150

X51872             1 --------------------------------------------------      0

V00295           151 tttttcttttacttttttatcatgggagcctacttcccgtttttcccgat    200

X51872             1 --------------------------------------------------      0

V00295           201 ttggctacatgacatcaaccatatcagcaaaagtgatacgggtattattt    250

X51872             1 --------------------------------------------------      0

V00295           251 ttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg    300



  [Part of this file has been deleted for brevity]


X51872          1310 ctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc   1359

V00295          1501 --------------------------------------------------   1500

X51872          1360 gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaag   1409

V00295          1501 --------------------------------------------------   1500

X51872          1410 aggcgacctcgcgggcgctttgccaccaccaggcaaagagcgcaacaacg   1459

V00295          1501 --------------------------------------------------   1500

X51872          1460 gcaggcagcgccaccaggcgagtgtttgataccaggtttcgctatgttga   1509

V00295          1501 --------------------------------------------------   1500

X51872          1510 actaaccagggcgttatggcggcaccaagcccaccgccgcccatcagagc   1559

V00295          1501 --------------------------------------------------   1500

X51872          1560 cgcggaccacagccccatcaccagtggcgtgcgctgctgaaaccgccgtt   1609

V00295          1501 --------------------------------------------------   1500

X51872          1610 taatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa   1659

V00295          1501 --------------------------------------------------   1500

X51872          1660 gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatc   1709

V00295          1501 --------------------------------------------------   1500

X51872          1710 aatgcaccgacggcaatcagcaacagactgatggcgacactgcgacgttc   1759

V00295          1501 --------------------------------------------------   1500

X51872          1760 gctgacatgctgatgaagccagcttccggccagcgccagcccgcccatgg   1809

V00295          1501 -----------------------   1500

X51872          1810 taaccaccggcagagcggtcgac   1832


#---------------------------------------
#
# Conflicts:          V00295          X51872
#              position base   position base Using
#
#
#---------------------------------------

  File: v00295.fasta

>V00295 V00295.1 E. coli lacY gene (codes for lactose permease).
ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaaataataataa
ccgggcaggccatgtctgcccgtatttcgcgtaaggaaatccattatgtactatttaaaa
aacacaaacttttggatgttcggtttattctttttcttttacttttttatcatgggagcc
tacttcccgtttttcccgatttggctacatgacatcaaccatatcagcaaaagtgatacg
ggtattatttttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg
ctttctgacaaactcgggctgcgcaaatacctgctgtggattattaccggcatgttagtg
atgtttgcgccgttctttatttttatcttcgggccactgttacaatacaacattttagta
ggatcgattgttggtggtatttatctaggcttttgttttaacgccggtgcgccagcagta
gaggcatttattgagaaagtcagccgtcgcagtaatttcgaatttggtcgcgcgcggatg
tttggctgtgttggctgggcgctgtgtgcctcgattgtcggcatcatgttcaccatcaat
aatcagtttgttttctggctgggctctggctgtgcactcatcctcgccgttttactcttt
ttcgccaaaacggatgcgccctcttctgccacggttgccaatgcggtaggtgccaaccat
tcggcatttagccttaagctggcactggaactgttcagacagccaaaactgtggtttttg
tcactgtatgttattggcgtttcctgcacctacgatgtttttgaccaacagtttgctaat
ttctttacttcgttctttgctaccggtgaacagggtacgcgggtatttggctacgtaacg
acaatgggcgaattacttaacgcctcgattatgttctttgcgccactgatcattaatcgc
atcggtgggaaaaacgccctgctgctggctggcactattatgtctgtacgtattattggc
tcatcgttcgccacctcagcgctggaagtggttattctgaaaacgctgcatatgtttgaa
gtaccgttcctgctggtgggctgctttaaatatattaccagccagtttgaagtgcgtttt
tcagcgacgatttatctggtctgtttctgcttctttaagcaactggcgatgatttttatg
tctgtactggcgggcaatatgtatgaaagcatcggtttccagggcgcttatctggtgctg
ggtctggtggcgctgggcttcaccttaatttccgtgttcacgcttagcggccccggcccg
ctttccctgctgcgtcgtcaggtgaatgaagtcgcttaagcaatcaatgtcggatgcggc
gcgacgcttatccgaccaacatatcataacggagtgatcgcattgaacatgccaatgacc
gaaagaataagagcaggcaagctatttaccgatatgtgcgaaggcttaccggaaaaaaga
cttcgtgggaaaacgttaatgtatgagtttaatcactcgcatccatcagaagttgaaaaa
agagaaagcctgattaaagaaatgtttgccacggtaggggaaaacgcctgggtagaaccg
cctgtctatttctcttacggttccaacatccatataggccgcaatttttatgcaaatttc
aatttaaccattgtcgatgactacacggtaacaatcggtgataacgtactgattgcaccc
aacgttactctttccgttacgggacaccctgtacaccatgaattgagaaaaaacggcgag
atgtactcttttccgataacgattggcaataacgtctggatcggaagtcatgtggttatt
aatccaggcgtcaccatcggggataattctgttattggcgcgggtagtatcgtcacaaaa
gacattccaccaaacgtcgtggcggctggcgttccttgtcgggttattcgcgaaataaac
gaccgggataagcactattatttcaaagattataaagttgaatcgtcagtttaaattata
aaaattgcctgatacgctgcgcttatcaggcctacaagttcagcgatctacattagccgc
atccggcatgaacaaagcgcaggaacaagcgtcgcatcatgcctctttgacccacagctg
cggaaaacgtactggtgcaaaacgcagggttatgatcatcagcccaacgacgcacagcgc
atgaaatgcccagtccatcaggtaattgccgctgatactacgcagcacgccagaaaacca
cggggcaagcccggcgatgataaaaccgattccctgcataaacgccaccagcttgccagc
aatagccggttgcacagagtgatcgagcgccagcagcaaacagagcggaaacgcgccgcc
cagacctaacccacacaccatcgcccacaataccggcaattgcatcggcagccagataaa
gccgcagaaccccaccagttgtaacaccagcgccagcattaacagtttgcgccgatcctg
atggcgagccatagcaggcatcagcaaagctcctgcggcttgcccaagcgtcatcaatgc
cagtaaggaaccgctgtactgcgcgctggcaccaatctcaatatagaaagcgggtaacca
ggcaatcaggctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc
gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaagaggcgacctc
gcgggcgctttgccaccaccaggcaaagagcgcaacaacggcaggcagcgccaccaggcg
agtgtttgataccaggtttcgctatgttgaactaaccagggcgttatggcggcaccaagc
ccaccgccgcccatcagagccgcggaccacagccccatcaccagtggcgtgcgctgctga
aaccgccgtttaatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa
gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatcaatgcaccga
cggcaatcagcaacagactgatggcgacactgcgacgttcgctgacatgctgatgaagcc
agcttccggccagcgccagcccgcccatggtaaccaccggcagagcggtcgac

Data files

   It reads the scoring matrix for the alignment from the standard EMBOSS
   'data' directory. By default it is the file 'EBLOSUM62' (for proteins)
   or the file 'EDNAFULL' (for nucleic sequences).

Notes

   This program was originally written to aid in the reconstruction of
   mRNA sequences which had been sequenced from both ends as a 5' and 3'
   EST (cDNA). eg. joining two reads produced by primer walking
   sequencing.

   The gap open and gap extension penalties have been set at a higher
   level than is usual (50 and 5). This was experimentally determined to
   give the best results with a set of poor quality EST test sequences.

References

   None.

Warnings

   Care should be taken to reverse one of the sequences (e.g. using the
   qualifier -sreverse2) if this is required to get them both in the
   correct orientation..

   merger uses the memory-hungry Needleman & Wunsch alignment. The
   required memory may be greater than the available memory when
   attempting to merge large (cosmid-sized or greater) sequences.

Diagnostic Error Messages

   None.

Exit status

   It exits with a status of 0

Known bugs

   None.

See also

   Program name     Description
   cons             Create a consensus sequence from a multiple alignment
   consambig        Create an ambiguous consensus sequence from a multiple
                    alignment
   megamerger       Merge two large overlapping DNA sequences

Author(s)

   Gary Williams formerly at:
   MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust
   Genome Campus, Hinxton, Cambridge, CB10 1SB, UK

   Please report all bugs to the EMBOSS bug team
   (emboss-bug (c) emboss.open-bio.org) not to the original author.

History

   Written (Gary Williams) 1999

Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.

Comments

   None
