mhmms
Usage: mhmms [options] <HMM file> <FASTA file>
Description:
mhmms searches a sequence database using a
Meta-MEME motif-based hidden Markov model (HMM) of the kind
produced by mhmm. Each sequence in the
database is assigned an E-value, and the IDs and scores of
sequences scoring below a given threshold are printed in sorted
order.
The E-value of a given sequence is the expected number of sequences which match the given model as well or better than this sequence that you would expect to see by chance in a random database of the same size as the given database. Scores are assigned using a local search algorithm; in other words, the algorithm finds the subsequence that matches a subset of model states with highest log-odds.
The emission probabilities in the model are converted to log-odds scores before performing the local search. This is done by combining pseudocount probabilities derived from a score matrix (see the '--pam' and '--score-file' options below) with the emission frequencies. You can control the relative weight placed on the emission probabilities versus the pseudocount probabilities (see '--pseudo-weight' below). The adjusted emission probabilities are then converted to odds by dividing by background probabilities (see '--bg-file' below). Finally, they are converted to log-odds scores by taking their logarithm.
Transition probabilities are converted to log-odds scores by taking their logarithms before searching. This can be overridden and the gap scores can be set explicitly using the '--gap-open' and '--gap-extend' switches, below. This allows you to specify a single affine gap cost function for all spacers in the model.
Input:
- <HMM file> - An HMM in Meta-MEME
format must be provided. If the filename is given as '-', then
mhmmswill attempt to read the HMM from standard input. - <FASTA file> -
mhmmsrequires a sequence database in FASTA format. If the filename is given as '-', thenmhmmswill attempt to read the database from standard input.
Output:
The mhmms output has up to three sections containing
your search results:
The second two sections will not be present unless the -fancy option was specified.
The results in all three sections are sorted by increasing E-value if possible, or by decreasing alignment score if E-values could not be computed.
DATABASE SEARCH RESULTS
The "Database Search Results" section consists of lines of the following form:
These fields contain, for each alignment,
- ID - The sequence identifier, as given in the database file.
- E-value - The E-value, which is the total number of alignments that you would expect with alignment scores as good as this alignment if the database contained only sequences unrelated to the query. Thus, a small E-value indicates a good alignment.
- Score - The Viterbi alignment score. The Viterbi algorithm finds the (local) path through the model that has the highest score with respect to the given database sequence. This probability is divided by the probability of the same sequence with respect to a simple, zero-order Markov background model. The resulting ratio (called the odds score) is converted to a logarithm (base 2) and is printed in this column. The Viterbi log-odds score is the basis for the E-value score in the previous column.
- Start - The position in the sequence where the alignment begins.
- End - The position in the sequence where the alignment ends.
- Length - The length of the sequence.
- Description - The sequence descriptor. This description is taken from the FASTA database file, and is truncated so that the output fits easily on one line.
ALIGNMENTS
Each alignment lists the sequence identifier, alignment E-value and log-odds score along the left. On the right, it shows the alignment of the model with the sequence in groups of three segments.
- Each segment contains, in the bottom-most line, 50 letters from the target database sequence, flanked by that segment's start and end locations within the entire sequence. Thus, the first segment would be flanked by \"1\" and \"49,\" the second by \"50\" and \"99,\" etc.
- Aligned above these 50-letter segments are the motifs in the
model. The motifs are labeled with numbers in the order they
appeared in the
MEMEoutput file from which the model was built. A plus or minus sign preceding a motif indicates that the motif occurs on the given (+) or reverse complement (-) of the DNA sequence in the database. Each position within a motif region is indicated by a letter, and each gap position is indicated with a period. - In between the sequence segment and the corresponding model positions is a line that indicates the degree of match between the motifs and the sequence. If the letter in the motif with the largest log-odds score appears in the sequence, then the match row contains that letter. If the sequence letter does not have the largest log-odds score, but does have a positive log-odds score, then the match row contains a plus sign. Otherwise, the match row is empty.
MOTIF DIAGRAMS
The motif diagrams section shows the alignments in schematic format. For each alignment, in the right two columns, it shows the sequence identifier and the alignment E-value. On the left, it shows the positions and spacings of the motifs in the alignment. Hits are labeled with numbers corresponding to the order the motifs were given in the query. A plus or minus sign preceding a motif indicates that the motif occurs on the given (+) or reverse complement (-) of the DNA sequence in the database.
LOG-ODDS SCORES
The log-odds scores for each motif column are created using prior information on the letters appearing in alignment columns. The prior information is the target frequencies [Karlin,S. and Altschul,S.F., PNAS USA , 87, 2264-2268] implicit in a scoring matrix. Meta-MEME can read a user-specified scoring matrix (in the same format as used by the BLAST family of programs) from a file or generate a PAM matrix. By default, PAM 250 is used for proteins, and PAM 1 is used for DNA. For DNA, the "PAM 1" frequency matrix is
.990 .002 .006 .002
.002 .990 .002 .006
.060 .002 .990 .020
.020 .060 .002 .990
Meta-MEME calculates the target frequencies qij = pipj exp(L sij) from the scoring matrix sij and the background letter frequencies pi by finding the value of L that makes the qij sum to one. These target frequencies are then used to create pseudo-frequencies to be added to the emission frequencies of the column, following the approach of [Henikoff,S. and Henikoff,J.G., JMB, 243, 574-578]. The pseudo-frequency for the ith letter is computed as: gi = sum j in alphabet (fj qij/pj).
The pseudo-frequencies, gi, are then combined with the emission frequencies, fi to give frequency estimates
In general, alpha should be proportional to the amount of independent information in the emission frequencies. We have set it to the constant 20. The parameter beta is arbitrary and controls the relative importance of prior information. We set it to the constant 10.
Our method is essentially that used in PSI-BLAST [Altschul,S.F et al., NAR, 25:17, 3389-3402] without
- sequence weighting, and
- scaling for amount of independent information (alpha).
To do 1) and 2) correctly would require having and using alignment information rather than emission frequencies as the starting point.
Options:
- --paths single|all - This option determines how
mhmmscomputes raw scores. With thesingleoption,mhmmscomputes the Viterbi score, which is the log-odds score associated with the single most likely match between the sequence and the model. Thealloption yields the total log-odds score, which is the sum of the log-odds of all sequence-to-model matches. The default is Viterbi scoring. - --p-thresh <p-value threshold> - The '--p-thresh' switch
activates p-value score mode with the given threshold. (The default
score mode is called "log-odds score mode".) In p-value score mode,
motif match scores are converted to their p-values. They are then
converted to bit scores as follows:
S = -log2(p/T)where S is the bit score of the hit, p is the p-value of the log-odds score, and T is the p-value threshold. In this way, only hits more significant than the p-value threshold get positive scores. The p-value threshold, T, must be in the range 0<T<=1. This mode of scoring automatically activates the '-motif-scoring' feature (described below under "Advanced Options:") so that partial motif hits are disallowed.
Note:
- If p-value threshold is too small, there may be few
(or no) "hits", and, consequently, few (or no) matches. This may
cause
mhmmsto be unable to compute match E-values, or to report no matches. Small values of the p-value threshold may also cause the reported E-values to be inaccurate. In this case, the E-values will always be too large (conservative). The proper value for the p-value threshold can only be determined by experimentation since it depends on the number of motifs, the information content of the motifs and the value of maxgap.
- If p-value threshold is too small, there may be few
(or no) "hits", and, consequently, few (or no) matches. This may
cause
- --both-strands - This allows matches to occur on either DNA strand. By default, motif matches are only on the given strand. The -both-strand switch implies the motif-scoring switch.
- --e-thresh <threshold> -
mhmmslists the sequences that have E-values below the given threshold. The default threshold is 10. - --fancy - The '--fancy' switch turns on a more detailed output format that shows, in addition to the score for each sequence, the complete model-to-sequence match. Here is an example of the fancy output format, showing a two-motif model matching a sequence of length 179:
-
*................................................. 170K_TRVPS 1 GAHLVPTKSGDADTYNANSDRTLCALLSELPLEKAVMVTYGGDDSLIAF 49 .........................FDWqKFAGtWH.............. D+ F G+ 170K_TRVPS 50 PRGTQFVDPCPKLATKWNFECKIFKYDVPMFCGKFLLKTSSCYEFVPDPV 99 .................................................. 170K_TRVPS 100 KVLTKLGKKSIKDVQHLAEIYISLNDSNRALGNYMVVSKLSESVSDRYLY 149 ......GYCPEVKPI...............* C+ K I 170K_TRVPS 150 KGDSVHALCALWKHIKSFTALCTLLPRRKG 179 - --width <int> - Specify the width (in characters) of each line in the output. The description of each sequence, which is taken from the input FASTA file, will be truncated as necessary. By default, the output width is 132 characters.
- --nosort - Do not sort the output.
- --bg-file <file> - This switch allows you to
specify a different background letter distribution. The background
letter distribution is used in converting the emission
probabilities in the model to log-odds. By default, the background
letter distribution of the appropriate (DNA or protein) NCBI
non-redundant database is used. With the '--bg-file' switch, the
background distribution is read from a file whose format is the
same as used by MEME and MAST. The file must contain one line for
each letter in the (unambiguous) character set. Each line must
contain the letter followed by the letter's frequency. All other
lines in the file are ignored, including comment lines starting
with '#'. For example, file might contain:
# tuple frequency_non_coding a 0.324 c 0.176 g 0.176 t 0.324(You can produce a file in the proper format from any FASTA sequence file (DNA or protein) using the fasta-get-markov utility, which is included with the Meta-MEME distribution in directory /bin. Type fasta-get-markov < f.fasta > f.bg to make a file named "f.bg" containing the letter distribution from FASTA file "f.fasta". ) - --allow-weak-motifs - In p-value score mode, weak motifs are
defined as ones where the best possible hit has a p-value less than
the p-value threshold. Such motifs cannot contribute to a match in
p-value score mode. By default,
mhmmscanrejects any search containing weak motifs, unless the -allow-weak-motifs switch is given. In that case, the search will proceed, but the weak motifs will never appear in any matches. Note:This switch only applies to p-value score mode. - --progress <value> - Print to standard error a progress message after every value sequences.
- --verbosity 1|2|3|4|5 - Set the verbosity level of the output to stderr. The default level is 2.
- --noheader - Do not put a header on the output file.
- --noparams - Do not list the parameters at the end of the output.
- --notime - Do not print the running time and host name at the end of the output.
- --quiet - Combine the previous three flags and set verbosity to 1.
Advanced Options:
- --zselo - Specifying the '--zselo' switch causes the spacer emission log-odds scores to be set to zero. This prevents regions of unusual base/residue composition matching spacers well when the spacer emission frequencies are different than the background frequencies. It is particularly useful with DNA models.
- --gap-open <cost> - The '--gap-open' switch causes all transitions into a spacer state to be assigned a log-odds score equal to -cost. Together with the '--gap-extend' switch, this allows you to specify an affine gap penalty function, overriding the gap penalty implicit in the model (transition probabilities into and out of gap states).
- --gap-extend <cost> - The '--gap-extend' switch causes all spacer self-loop log-odds scores to be set to -cost. In addition, it causes all other transitions out of a spacer to be set to zero. Together with the '--gap-open' switch, this allows you to specify an affine gap penalty function, overriding the gap penalty implicit in the model (self-loop transition probabilities of gap states).
The following option is automatically invoked when you specify --p-thresh. You can also set it when you do not want p-value score but want to prevent partial matches to motifs.
- --motif-scoring - This option prevents alignments from containing a partial motif.
The following options can be used in both p-value and log-odds score modes to control how the emission probabilities in the HMM are converted into log-odds scores.
- --pseudo-weight <weight on pseudocounts> - By default, the pseudocount probabilities are weighted by 10, and emission probabilities in the model by 20. The weight on the pseudocount probabilities can be adjusted to any value greater than or equal to zero using the '--pseudo-weight' switch. The smaller the weight, the less effect the pseudocount probabilities have, and the closer the adjusted probabilities will be to the emission probabilities in the model.
- --pam <distance> - By default, target probabilities are
derived from the distance-250 PAM matrix for proteins, and
from a distance-1 transition/transversion matrix for DNA.
With the '-pam' switch, you can specify a different integer
distance from 1 to 500. (This can be overridden with the
'--score-file' switch, below). The distance-1
transition/transversion joint probability matrix for DNA is given
below:
A C G T A .990 .002 .006 .002 C .002 .990 .002 .006 G .006 .002 .990 .002 T .002 .006 .002 .990 - --score-file <score file> - The '--score-file' switch causes a score file (in BLAST format) to be read and used instead of the built-in PAM (for proteins) or transition/transversion (for DNA) score file. Several score files are provided (including BLOSUM62) in directory mhmm/data. Other, user-provided score files may be specified as well, as long as they are in the proper format.
Bugs: None known.
Author: William Stafford Noble.